LBU` ﾭ G)(@@ @44 PXdMMOР iHM (B B H4P MMOР iHM (B B H4P $MMOР iHMT!(B B H4P vMMOР iHM!(B B H4P gMMOР iHM"(B B H4P XDMMOР iHMt"(B B H4P RMMOР iHM"(B B H4P 10@-@`Z  q @-VZ ^QZ a @- OZ  0@-DMD @ MP@P,  00DЍ0 /////////@-!Z @-LA0C H  H  1   0A c1 3/P 0S0@ZYNY7^@o_Z+MP  ỖpMP  㐇X0TzMP H @YViDH ( 0 8 ? G P ^ Y //@- 嘉@͗a p@-M@ 㰅000,00<8 40@PY($ 0Y00 0Y00  0Yz Z c0C0bvVVdnNY@0TT  @018 00uYЍp x    A t 8 Q @-@eY@p @-@\Y@ @-@SY@ @-@JY@ @-@AY@| @-@8Y|@s @-@/Ys@j s@-@`PT  ІT @0S@PU|@-@L0   0 0 0  @-M@ Ȉ*NЍ 40@-P M@    Ѝ ? /0/ p@-DP`@TpP 0@0Tpp @0 R/0Q 00S // D 0S/ S 00S S// 8@-tP@ R0X1LP 広P 4M00Q0@00008 D-A000P@UhlPڒ@Th`X?GhPRTLP@qA>h8RX4VXZ  }P@EX X  qP ` jP   dP 3X0X -X  '0@0PTT`Q hKP FP 0D8IM X h '>   5 @- @P,03/0   @-(0 P $0 3/ @-0P (03/ @-@yKP xPl 0ST0000PiKD@P P ,L 0R0  U _  @-p`0S@PW! P   㞃0@ \0TPP@ 03/P,0 0 0U p@-P0SpJ 0S@ 0S \K@ 0D@S P 喂Pp0000U 0 p@L 0 0P/ b <, <4 /0 / / C@- >@- 0 P   @-.0  0/ 8@- @PP P8 ّP8 @-J@P BP =P 8P  ᶄ@0S:|@000p3? 0S0 0 0$0S 00,0000j s _ w '0 A0Q(#8"8#8 /@-00s3000#$$( 0r"( *" S/( @-0`0@#ttxw'xpPz 㡂'z` 㜂8W#8X%\40 X %\'$t4p1(  5 QN-P04^ڀ%ş0 #"D$ `5( P"(`` R , 4ş+ [ʴ@ +A [@AQ6 S3 0#,4 : #:+@A ğ P S:#:S4[ 4[`  [Q]ڰ0#$48S 0#$48SZ0St80S  80`P0#$48#8S S U<0 @ ( 8LC<0S @0S D0P @@ H݁HL0<0L0@0Q 70#$48S0#$48S 0#$48S 2R /hR8nP0`SPg \婁 0Q0# ) Q ЍNU0 @Rr0So PЍNU >180S Pp\0#tty'yV 0S=`Q Q Q J0SGPЍNcU 1 0;  V  Q0pp 0  l0I0pcЍN>S!1!"$#48((#8!"(0C 08#8001QQ8 (#$48#8108#81H0`c`L`lphT D- 0P 8#xE 7 `#,`#4| 08 | #,#40@00000@ 0`8 X*<p*x%<%T'<'tᴡQqa L N-pQP0`p Q 1wP@v =P$H+ @P} }p40P` @ VI   ~0UPEQ!01000 0܍8 p@-M@ ~t`0P0S 0SPU D0T 0TPۍp 0@-M }d0 P R R  R @T  }ۍ 0@-M }`T0 P R  R @T @ }ۍ 0@-M }?\0 P R R  R@T0 }ۍ D-P0@MM`p0 0U !a}h0Q`P W}D0To 00 4 T  P$PT0(Ѝۍ T L 0@-@DMP@@@ @40 0@DЍ0蠆p@-M`y|@ P T00C1 ! }0@B@Q@ P0bC1ڍp襆H0@- Mr 0S @ 0dC1 rڍ p@-M`>|@ | P| $P T00C1 ! |0@B@Q@ P0bC1Hڍp @-MMp `zT P@|\ Y0(0 $,@0eC1)Ѝڍ 0@-MM \ @0 P P|0d C1Ѝڍ0 p0X  BR***+++ +@89\Os` d/ 4 @-M0M d|@0P(0S% 0S"0SPU 0/S` h\Z{\{ p\A|\0`P\  9|\0PЍۍ v @ @-h00Sh0(!P@P}@ x ,,p@-`Md |00P@50S1 0S0S0S S%@`"@P 廰Q|O㴰Q#O`H0P 0dP@ {00 RP5 @ۍp 4  p@-A T0QpX00CS^..4.T.. /.` 0P 0X0J(AP,0 !AP O0O0l00p@P 0X00;d0&@`P }O0\+\P`'`@\P\|@}JT`0 @@ 0S 0T l  X p@p  4 ,,s@-A0l01Q0P0p0\00S1! !4!0\9zx\6O :wz`P\ P\(z A\\P`00@\POP O0S 00S  0R O0@\` NQ Nuw0N}|,0 X /T h XzЍp@M H ^ 0  4 $ ` \ X  \   8  ,,-L @-DfB0P 0nS,0  yP@a@|   0A-`NP <p@00P0<0 Ppz dz Pz00000`,,Y(AR T  , 5 0 3100@-0 S hN@O@@ x 3\17@-PP!00C@SD304\4404<0PMyyPFyPBy ~y0 0 P~P@d;008#,#48#80@<0<0ly@ <0<0Ly@@0@,>T ) / 7 8 ; I X L H @-0@@00 S,M@ M@ 8 x 4A-`l" QQ VSpPC0#$48#8S{ S S2 `@ `q xP l{`@V:AOU0#DDH$H1T@   p! !MD "Q#M8Q,M1 RR  Q `  }M1`0 S@000E0 0C## PE ``y0 R`50U(lQMh0 0#$$(H"(LM@CMA* 8 k s   4   s@-,@P  {2b2P B0U01! !4!0| xPM:SxPP xPX x00LATLL8!LD0S 810S !  0R L ALLQ LTu L0@LL00lPE0`000`q?` |x<0Ѝp@F 8 ^ H 0  4 $  \ X  \   8 +  4T5L <, <4 / x x@- xN-@`቟lps3QPK Q Q QcQb Q. Q\;Q:QY*5QW 6QS6BQR CQN3XTIH0S8AU   0AL :x1 ?U @02L? +x0 p!Uڌ 0Ll 0Z0R0S xL  xlphTLP@ T(QX \ @ x   H L    @-@cP0}5 0 9@Rp` ?600 0 @@@$` U .02    `@@$@ R?pP w0  P` w`07   00000  d@P @-00! wDQCRF-@MS0 CSRS0S0S 2 P 2Pr6Pt"7w+l0P00㪫` < 4 8?w  1B  0B0`cC D0`Ma1PP0Z5R0S S  0 RL01P4P{ x 0S r1 l@vFvP  0S @0 J>0P 0nS0   vP| tJ R R RVЍH cScT C, 0 H ( L ^ P     N-xaxPl PJ@T!}v+L@PLp < (,04 8v  0B0  0#쐉  0C pcD0HH/0@ 0' pЍNtH T 5 , ^ C >00@-0 S 7J@@H x Cp@-H`H0 @004P ,00p0 v@T 00p Pp@-8P` @}vp@T0  p 8@- @P080Pfv 0p@-$ @ ` $ lYvh+JP@000d P@2B 0Pc0P`0>00 0$0p@?v P@-@`0PP" 0$0PPx0Pt`$0)vpd`pP``$0D;$0v~P0     ,P NN-R@`P(pI]b0PZU. ll!P@$ 0n0 $0JU $E &40 0^<0S $:P $ 6 ` `P<0S0$0,$) `8#800@P$0 <<0S  00PU\@".\P 0$0 $6000P$PI   & , F-R@pP `xxVld IQPN8#8HU00U81@$0 U<0S0$09'40 0$3 <0S 0 p p@P$"<0S 0 $  0@ 0T"T@\P0$0  $ 400P$PI ' h  .<, <4 /@-13/-0$M0 00 1 3/$Ѝ8 @-0\0S H\  N-0M@PP`5 7 Vp1 p!W000<0 S0 000000,00$0(p1 3/ P W 000 0 1 3/ P 8ZH@f0)`kV@0Ѝ N-0M@PP`5 7 Vp1 p!W000<0 S0 000000,00$0(p1 3/ P W 000 0 1 3/ P 8H@f0)`kV@0Ѝ @-@ Met 1    3/@P}Xt Ѝ@-`$M@_70 000  1 3/pP()00 000,0R0101  3/pP0t 0SPU*U < 0P0Q B0 00<007p$Ѝ @-$M@_`00,0 10` 1 3/pPt 0SPU* U(P0000 <0wp$Ѝ-04M000000,0 (0, $0 1 3/4Ѝ(-$M$4 0 1 3/$Ѝ0 0Q0@-@H0M(@-`@PpP$ 01/@-0@` Ppn@}  G  N-M8 0`S0  00 SpQ RO*@UTJ*P@P ?! @ᛟ @P᝟0T @, 0SR1:\ Ꮯ03/ 00P@00C000Y00S\ 00 3/P O>P p00(0T0 j02,0t0! P0! 0P0t0Y jP[ 0EW:(, $0PW0t0miPkWPPm $ j0m?Y  0 0 B ~   D(0 {  dbk8^ilfg[ DeHlp^ jf$h ܫ̬D_X`j/ s  hv}unn(n$oPo@-@.P@@-@D7L0@>7@-P[ @\@T@ `p`W@ TU  0S\-,M$ 0 L1/,ЍN-p0XM @`P XP  b ; 0 0  4004 w X  B╖p,n` W5jXI ႖ ,ቖX 4 !P8 p0P  0 h P, [P p/0D0TLP88L"1/P0  Q P Y PP p1!!!000X0 3p,WXЍ0 N-0@ P(M00XP0p  0c` 0 p@00 `   @p$@;p' 咩%X 0  00 0P 0 P p  0 000YP pX 尕p 0dSP$` q44( 4P` U(Ѝ  N-8M`PXp$AP áᐕ@\ kXp w40Z p10$00p@!1/P40S t4Xl4,F$p ((QZ5 ` R Z 0X Y 0x4\!1000 X D0 c4Z\\!1 000X@pW  [:! p, 0 g!Z 8Ѝ0 Y   N-`M`pP@`yYX  p  0 RPX  `p`0V X ֔   `0 9ЍN-@Md0P0p00P0`ppp@ X 峔{` pLLdI!1`  00`T00  0CD PX0\?3"0p Ą8 0SPIp00  R B R B BRR/R B²R00/00  R B R B BRR/R B°R  /0 0000q/3t ` , ` /3t000#2!0!!/@-@@0@8 4000#&" pP  ",' CQ/QQ/3` 0 * ` /30/3d/3 ?#?+ ?#?+ ?#?+ 0?3?; 0/0@-M @ 00!Ǡ[!%ό"?ˠ,")S @Ѝ0@-@0Q0 SfS!300?#!4<!400# 3="5+!"+ 0 d000 0: 0`0 :`0d A   Q  R3d 0% P0! dP R  1!a`  1!a`Q6̠`ԗ &ėR:ЍpL08x lH L0 0000H00D00@00<0080(0400000,0,0/@$<t l`@-@-zh ᖎ@-C Pp@-@ P`A ^p@Z  0AS 8@-P@P8@- 0@H 0@G @-@0@D@ 0| 0 000 00 A  0/0| 0 0 00 00  A  0/0  /0 //@-@ - - -x - dt- Th-dX:!T P H-@-<-Ѝ       ?   + ? @-03/Rp@-@,+@ P[`,j-D @P@a-pw  <, <4 /@- 7Pf PP@-`@E-%=4/n PP0@-@MPP ` 4 ]0000 0RЍ0 PP@-@@PM ` 0 \ $N" 0PЍ G PPN-Pp@?`"0S`0 :0S`U BXY  . 0 0p 0W*X[0Dq @P`@4,< 04/Ѝ 8  @-^ 00csV'8@-@,;PP|,Pl U:PX,:H,^:P8 4,P(,P8  5 J b }   RA-@pP`80A &Z`PPV輰 N-`0,(@4P8p0:[ ['TV,S, T   8p:000@,D,0 UP000 x1,W <` 0,@%,W  < T#*0S     5 N-DCp`K/W( :,V:P: /VW2@ Y@;:밲TP@P:Pa+%넠P|+#;9PX+;":Z 4+9P + +;Q +;P4;0崡S S SP T09W PY@@0 P0,Tl+0@ W0@D0j;0+kd; P젟T0S V:P@0]00\0^ @00L0 D0SX\+Y` d00h00 05:P \E+0 HP 8 X _ 8 M b        7 [ ///D- M`P p@(P ZE PT\A0 SP+(PJ00^ 01 Za( Z Z=@Z) Z80X00\00]000 0H00PP)X  abU#  06/PP   06/PPl   06/PP H*  06/P Ѝ 8  $    N-R@MP0p`<08 `X800:SS #S   0q PxA@X00\00]00<0 0H00Pp pD0S "0Sxv*ps*pZ:  0Qip[ 8$< X aT]0 @S[ P UpP 0T #Z)`0F3/!$:^ 0AT [ v`@^r8^ l3*:  04/ :  0i@Ѝ8 C _ ` d $ F-?p唠P *@4 4`D.I.0O0R \.0S0)0S< ) Y )@TT% H ?$ [$ o D-p@`VP \PP0cSPp )P`VW )@-@`phPP h4/U@ h@-40 R(1S )ELF$ % p@-P(M@`  ( U0 P  R 0SgUU 4h`(P3V(ЍpRp@-`02ՀMP@ !WU@ TPPua)X)PB\  WP`P TP ! 3IU@ Y`P T0hh!0 Y T0LD!Y@`P ~T0( X`P sT0 X`P hT0 X aT P ! 3U YTP!3gGP V@x( p(h(4/\(Ѝp輰 =% B% {% %  % P % % % 8 % Y %  % % & )& M& p@-@PgP ggP gTp0` tV`P@ `0(D @P@(p輰 d& & R@-0 RV0c BN-@pMR&/P|  9V`$P  0VP  (V P"V%&Ub(ul VpjyP  X(l0S` :S lU`P   yP`@ P qSP @ 6( 00, 0`-( 0'( xP oxP 0(xP(Y Y 1 Mx P  0`(xxp0p 'd `WX`)pЍG pP k' q( ( ' ' rg ' ' ' ( H( + ^( m( d RD-@Pʍ%  UpxP '+0S` :S ' gU`T  @d@0xP\ wPL 0'uw@P ('wwp( ( v ' ( ( R@-Pʰ'( 7U`xpP 0S :S dp' !U@@ hP $ 0c'j8* a* ( }* RD-@PU'@0 UpVxP 0S :S 9'@ T`` gP H 0,'T ,jP@ "'* a* ( * v + RF-@MP@'  TpxP&>0S :S T`` gP  0& TT   T  Xjp@X 0`&@&8 V,Ѝ+ a* ( [+ + + ` d @-$$ `0A 0|$ m۶<, <4 /N-SM81p`@" %  @=T  p8T0 P .R `0`FV 1$OR Z`,o& 0@P ^& T! T!W&8P[PT! ST  T x0R  0@P L*&HR[P0p`Ѝd - - - - - - ! - N/a 0P/aN-`1 M P@1R0 0p# S S0P .Rp@0@DT #DR pW@Z  S pW``  0`1P %% %P[%  0A^Sl%d%[ %pfW 0 P@0 Ѝd h . . #. = ) N F-0BSM`P BS =S 0p.Q0@0@DT 6#&Q 0S@  $SU SP  02`P $V% QPEpUЍ- *RN-@p R R 0P.Q0`0`FV ".Q 0S`  R E@p x"% 0 x PpGP @MWT $% %Ѝ). - V @-<$@'P$$@T $H. ^. RF-`MPp R R 0.Q 0@0@DT "ЍQ 0S@  tRP`1`#U_  jRP  0`P $Q. R@-@H$ NR@($}@P $d. z. . F-@PB `pOP 0 ЍF OP 0 ЍFYd OPp @ OP 0 ЍF OPp 04 }OP 0 ЍF pOP 0 ЍF/ cOPt , ` XOP 0 ЍF+! Ѝ k . . . . . 1 a. *R/ Q@- @*R Q QA0N-P=O@ap[ OPT1OWPU@& ` P$Op!OP 1 !NT@p38P5P P". ` T#dt0`sVVVV V@hT#l 1 R@-@ 3!" 0RTllDDlD  0pX#p31 @-P 0Q105 3:0SL  HSD  04C#Q 0 S1 1 1 1 @-EP<080@P ((&#2mp3  1 2 R@-@D@(P4000P kp3v   D-q`P@P@Z@ Z P@P P'00`P  0" k`P  0ph"d RXP< 0"VЍ輰 P 2   2 2 <2 l2 d o2 0   /| 0 R  /| @-CMMB~ p0`B$4CPP@  @PN 9D P,E@`"B DLD*a 4v"  (DR 4ЍۍE XK3 m( d @-P"P @F"@-@L"Pt"PR@-P`dM@`  OT`P O`<"!" P P:q@V  ` 0 @!$C# C`F0 $ CTVT  08#<0!<!<%<0<00`0 Q P VP@0P( $!dЍs3 3 4 3 3 3 3 N-P Mp@a帱B/?6Pb@P,<<<8 <#M<3 T @!0C W p1PPd$(N0 P!f` Q820SPdmQ.!? 0! R0 0!0S S  S S 000 S !P 0Z000 cZ ݍԱ l '&4 ` d 8@-P@ 0P 1R  T @ 9O@lZ!id@PA!P 8!M@Tu0J!8$E!0P84 Ա 4 4 4 8@-P @'!@DT8| `0@S/0?S@/00 R,"??/@-@ !Pp@-L@00 "0060P0P)00P p@| p@-L@00 "00+0P0P)00P p@| @-0 , 003/| 0, 4 8  < /| 04 , 8 <  /| @-@@, R @03/0D R0,0@03/| 1 A-) H  # D _ Q^ AH HPL PbUp`@~0PU0`; !0PU0`6 N0PU 0C0 0 00`- O]PE@0U0`$ P0PU 0C)0-00` Q0D0PU#00 ` +0PU0 ` 1 PU ` U0 ` "   `^ ! \@00 p 0`0pY0pP0P*``)0 0PA*| N-(MPpPC  M@U` MU@ MPP U & LP1|L PhFKP\  mD @ 830043@0 0)0p0D0@ ppPPHP Po@X T pIp WH  @D@@Dt 1@= 09 00 3  !? R+ 0C @D0@_4$   D[@DS[H0 !S0!H0Tʊ0 ,"? S P 0 p S[sB[< 0p@PpdjP aKZ$^ p >Otpc^@U XTK`cDK7P (ЍP,(0@pAPG p4 P(5 .5 | m5 $@ K3 m( d 5 4 5 RF-@=P`BQJP`FVP@@ L0p pL ~GTP  J| 0V  LP LP  J$ 07 7 7 R@-(@ L 8 RN-P`V |LUQ  uLUL  nLU@  fLPP%[ ZJ Y*  0  S:p` R 0P x p`0V:T@d@Pe2130@28 8 [8 8 8 Rp@-`5PP0 L @ LP U0U00U 00CS U 00CS  00CS pRF-P @P& K` pK ` KPp`LT00 T0000Pp` 8 R@-` OKPPJ K Ap pK@ @ K`#U  0R 00@!U 0R 0 0R 00@`p@PU @P0UL  @@ @V<0< 0@ 8 9 V9 8 8 8 (> 8 9 D-`0BS@EpP 4Kl0P P-KT   %KW W㰠P@P Rp@-@p  KP 0`I`V:jP Ap6 F-S@( > q` `P5  JPPpf+V V!/P P 00-ST P00P hJ X0R V VTP0` -  9 #. - ! @-0 0@-0 0N-p0R `@Pʌ$+@P  zJ`[`   rJPM} 0d&iE0 `P@ ر Rp@-@]p  QJP 0`H`V:P p6 7@-P@ 6J0 -R +J>N-`(Mp $ Q$ W0P,2, 0b%300600E400d p @0! 0 D0SQ@Q1  Q1 |!Qx10 p  0+QF PRL1L 0".SQ:00S ! S!  S+Q)00S  S    0S P00[: ppW`q Q(Ѝܱ D= n= = = = = = = = = $= /= = = > > > q RN-`8MP@4@ 0  1  7  6 5  14 2000FP01@͕0Ӆ10ͅU 76 U 54 U  EI/00iSp2U7@6PP@(200( 30/P300(`2$0 e0#P<0#0,P   a@@T@rS7P@4/5`02 .0O/P  G@7 60R5 40R P 9D6``40V76 Q 5 R (PP60S*awS7P@5`  2:/P  @``40S*PP60S*C0x 6F@P-50S40S7`ݕ!H@@5P 0.P  @PP4 RZ 5_``60S*0 F@PU /.x@00 1  7  6  5 4  " 8Ѝ B= n( .> *> 2> y> > > q > > >  @-P`pRUV@ L @H_PdF=UP:R@- (H@P5 rpoml!hp l""80",\YV00tt#" h 0L<X0X QLDH)A@@>D D D D E E D w %E D D 7E JE ZE F-PpRT T  d T LE@Pv GoPr q>E@Pk 3i6E`P* G P G G @GpH`PK  04 0?PU @P<0 9?P B0(P 00%0! P$`V! 0p  SP W 1W D10 `0 `P RS:?P(,>000 01(0S FP >P ' 0T@P 00'0 0F@P(Ѝ 9`PNJ >PwP0S0S J I yN J J J K K ;K 1 1 1 [K H ( K I K K "L 4 RD-P`M`@\>pP LD<pB,>pPi <cP8V@T"0 R R 0;`8pP 0000 0,PpU@ T0Sd @DP P 00 R ğR   3 00FS>PT _0JP`3T_ PP P PU)>p &>`#>````P >P``?VŸQ  0BX PX@T 0 PP T2 R PP@@0 @Uo@0s 00c0 0R@Q 0S !S 0zQt P}PD XOVK=PF@X_ T0`P8XPT@pWP3(0 U `P V$@ 0 0R0  B ` 0 000?0V0C0 P `ЍFL J I yN NL  1 1 1 UL vL L L L M 'M 3M B AM OM SM M 8 M H !I DI M M M N 0@-M@PP!Tʄ 0P`0   00 R< 8R40 0Ѝ0+N  1 1 1 FN 7@-P @m?P 0p3>p@-LP0S#@`8`Q(0T% "%p@h z S S F-`1MP@p0P1PUPR 0&PK000S 0r*0Y P 0 0R0000 !\=00Y PM 00c0l D @PUTH4@7ЍnPꤟ S h S S T T N- M@ ` .p@b<PP E<P @<P ;<P | 4l   00* 0@jP 47 P@8 PP9 ; 09,#,$8#4@00   0@jpP 8 9 : x0x@c0PP d;`PP T`  0 Ѝ)T 0T 3T 6T UT uT T s T R@-`MP@.RppP&P#  01P 000S }BU<ʔ10 ,> 00 00`11!0 N4PEM U#`+ l+ + + 10 >P >Pp = P =p 4"  5 U156  =PLP 0SH(67 0 00ЍT ph T T T N-P0XMp`VP@ @d@8p ;0<00D0080pP`LT 01/PT  J0@) p"[ 0    $ (,0@pGWP BQTT T0TTTT T@PEU@ XЍU 5U TU fU U U N-PM P$U`P  .=`P`@:pP e6 @T p:pP"U  UT6@T HV@ =@P6 REI@5@mm:P/ h:P*  l:P$  f:P  `:P Q:P |L:P lG:P \B:P L=:P50St 0S ,-:PL 01/P L0L 0L0L @PUT:@ l :P h:P@U p:Pp09(4@p@3T4H00 i#L0%P4 :L080TH040@p<` yP P0D0 @4LFg3P@D 9`PU .9 @:<TL D9PL  L d@p@3 9P  9PiU < xp9h2h`p`3V|XH00E "L0Pw.9@P Xt9P Ho9P 8j9P VL H0 0h0gW9PP @ H9LV00@@ 0pL P0L01/<1@Vl! TX1tH 0 d,@T@**9PPU p@ ;0` 1/P   @ PEUl9P @PЍpU %F h yn XV V V !V EV U 7P H87P Y0 N P0S3%70P 09"0[ 0S   J8F8 P0S0UPE0ŕ PR  R00Y0S0P} PR0 RUP7 0 060 0 S  |ppe[Ŗ 0R P R =`V0` R`I46PP; $6PP 0`@PT  9TT @0S@`V<%<,4X%T 0P6PP 90 tw6PPh pPPЍ\ Ĵ _ %] ,] 3]  l F] 4 Ph] ? 8 G P ^ N-AMP0`4Y @$d dBY Y pI  :P$ :VA.0 $C`05N6p` ZA.`F  8d0PPPU ]D0U  ÷0S(0+4Aލ]  ! R@-ʆ @@-40Q0  0S tЍ] R@-@Mf J P  w:  ۍ'> ] D-@MPp@&WPpp`b 0`V@CWt `ZWV k b PW DP@@ЍRD-@pP`PPHH P P  P $ E P`V] ] RD-P`@ p]5 P^`FVY  700S@Q 0:SS  J:SP@ 0SB 7 00SP;V0   700S. 00S*V  7 R0 R0 d`PX HrP d`0P! 0 :20S5 4P 4P=V9  l700SP0 00S,  _700S`# 00S  R7 00S 00SU4 ? 41 P0 3P93P}33P.3P_|)3P$3렯iX3P   5  5 0`sW 3P   5  5ZF2P   5  5Z42P  5 5Z"L2P   5  }5Z2P  p5  k5ZUUW P`iV A[ z3z3 2PP !P p f f f f V O1 S1 >1 D1 K1 :1 \1 @1 U1 N-RpM R RC 4@ 4@P-l 4`N# 0PS9 `0S"l0S :Sh l4pp XP , D2$ 200< 0%=0D  -2P  '2P  D00 $0` 0 Q-AM <^P Aߍ2i 7@-1@S<!a0P0#4 1P(1PH1P ( H01S |!hh!8TP!C?0B/ $#4>?i \i ii q ti i i 7@-@Px0ll @  0\00T0 0Lz0S <u, Ѝ0@n Ѝ0j i i 8 j +j j q p@-@P`^ PZLX 8R0Sp(M`p@GIj ]j j q j @-|0|  @l800S\ ST SLL,H)00S0"(@j j j i j j j j j q G-@`P㬠G p J%1YP`1UGq F-@P?0p` 00Pp S&R0j\ \0C\0S8Y 0  C W 0 0p|p p0 0!80 pS  S 10 /P(/PH/P H00 (0p6S  P `6Z&> k  S j k k k &k i @- M@ >0 l ЍD- `P /P  /P nJPH$3 t/@P:[30S  e/@P+p Y/@P"U PP ?@ T 1` PP 0S @ T 0/PD  (/P*UP@ 0`S TP xtU@T 1P 0@S ,UtUrF.P.10S<U' f1 Qp `1 `[1 @0 0`@G  5k ȴ Gk Lk `% \k k k k k k k n q k k E l %l mE pE Vl kl ol l l !V @- 1E  N-P1M@`$Tm 0T`f  0TP  0PPp:`  0,#,$8#48!S4P ;0S0S 0[ P Z:   0Tp . |2pd 2\pЍ P꼰 X n V'8 M  n b   o o 3o m d @-@T T @ 0D@s@P00S8004@$PP 00<@ 8 F-P.@-Ppj -pY)`@  -P-W `P@ TV@@0 0aC1 m۶@-P00pb @-@@ B8?P$30 'o o o N-MY@pP`O100$ M 0   R`DpP ( ,0 6-( ,0P pZWP`FV 0p 0 `P V x 0PUPP$  `P P$P` VKo o @-{y @v{^ ] :a N-M 0 0P8 0,`P-@P 0`SŬ,3p R R R @ 0 RRR RT00!0TD0$0x3 `pV0d3l0= `SBTV V VtP \0$07$00 t0';[pPS 0 G00R .  I$R&R000R000$R0    0 00' @ 0fS  ` 0`       000pp̴ P/0@  @/@/P    D0  <04,0Q0@///̴  0@-@ #P  0R00/  0S 0/  0R00/ @-0@(& '  P  @-8@0S(; {   P p N-@ 0`@P1&PEP P2 P=p&PPg&P RU &P T U00 p01 @a@ 0 e& 00K`PP 01Ѝ8 0/8@-t@0ShP\ 0(3/PP <| (00 00 0:/0S 00iz0 0j44"0Z 044( $W R W$# WZ 0SS0 0 0PQ@@TI 8ЍT V  r =r N-0M@` uP`  =0S  005 0N0S Z 03/[ 0KS(0S [   P Z  Z(0S 0S. [ &Z #Z $Z/ "Z;Z 'Z\Z |Z 0S (0S 03/03/ Pp#( y (  03/03/00 0   03/ 03/0000_P0S 0?P {P .0     03/S 0  03/ 03/}Pp}P;9 0,00S8  03/'Ppp&#0,0(00s03(0 J  D&Y 03/   9|Y 03/ F 03/p\1  (8l1  M   P u0 S, 1PRP$P,%u00S  0R 0,000S00,(0 S ,$z  U0ЍY0S |r T r r @-000,0000 000 lЍ ` 8@- t t t 1t Gt ]t jt zt 8@-P@ P qP8 @0S8 lw  b x u h s @-P//F-(p,PP`@8PD eD0SFS @P Pl H <T DP0 $ 0S0 S0S  @0 0u"0S   0000Y0   O`xPk t 8 M b   t t u D-p0@SP`( 0u Sx00C00 Sx0 Si0000TYU [00C000C04 8 A-Q@P` \#p BWA8pQp paW GR0`P  2000pW0 P  "000w /@-OGP@  @0P0T0S`% PP P@|_pcWPPU@D\0%T00Sp UY w w f w 'w 0N-0 Mp@ (0S00 0  0PS8 W 000PP` dX` <0 0@GPEU P P  P000!SSz gZ0 Z [P  <0 0@ !A0@ST < < < \ 0C<0 0@JZ P Pa PB P7 kP &P(  55:P PPe P`& P P P PTPi Pf00C0Z0 S* 00Zx 00C P*JZ     Z*00C0W0 S1:Q 0Z:0 RJ500C00SZ5 0Z:0 RJZ# J j     Y*00C00S& C8r    R0 4!0S S 0S0000S #1Y 꼓mTj00C0Z0S  ^0Z:W0 RJ0 \ R/*b Q00(0 S*90 000 0"0uP  00b   000<0 0@8bD2 1 0 0S0S00 00 01 1 uP0 XБP` V V V2 V 7V  V2V V-$0h0dM00I,00C00 S00P`0 =0SP0 S 0/P0 S V00 0PPP0|00000000`000 Ѝ 4 w , 8  ! 8 0 +C, ! 8@-@P 0 S S S @ 0 SSS S1TP a8w N-M@MPT 0S  P:TF⁾G@p'QS\P "R  S;QP S\Q  0Q 0 {A 00P @_P`@DO \F~\Q\ TU `@D\P P \Q'VPA$VP$`;6(V{V P3 $Z . ))V}V &QDA u PJZQ \Q'VQ`J'`ZTZA@00IP+P$  P`P0ZW 0\ P> 0P$0@p@Tp % x 0P/ % F-Pl@`PpX P  0,< 0   d>x x y 7@- 0P@,P\ 0   0!P 0,0  ,>%y 0y >y /00@  R/a0@SW@/A0@S7@/8@-@PP8P8N-@PSSp 0pS`V ` pP~00F Sx   $ 4  @ ` @ ` @ ` @ ` `  @ ` @ ` @ `  RpH<,!C<#J$#J%#J<P:pP304p0P*0p4000P 40 pP sP  pP0UfP P```@/L% @-pP@`4P 4@EuP PU@@% 8@-PP@ <8@P < 0 48@-P (048 840408 % t0-4 DM4 8 ` < H 1080$040(00000(0,0DЍ% aby  ( !0|0/.  S0/@-@J@DT 0P/   H`% p03/`% HD-0`PVrBZ 0$4p0,Ġ1'tp@6D0 0( 0FV 6SF @`% l% S8@-@ƀGP6PESU0&P 88|/F-`P㬐  T T0T}p 1 @WP⬠1Ue$pN @N- 0@S` Y QQ01 pᬰ/0S S$0 S qG 01  7 0%10&1G#&! &!%1J/%  0S 0PE0 Riy h0@- w`p1M4P $K/  0@P P/PV0wt0p00 Vh`l` @ 0ppЍ$(@-"(M@h 08#8 0d00  0Ѝ@-@p `0P`P PPD 0 4 S0 0y y @-0d 0 0 00 0Ѝ0@-MA0 QU#&1S0Slh0("(1 4 ! }/  0Ѝ0y h 0@-M!!$d0  @00 0PlpЍ@-h("(0  Č! d   !0iЍ4@-8h@M#800!0 0d00  !0PЍ48@-#8M@h0 00$08#8! 0d00  =03Ѝ48@-#8M@h0 00$08#8! 0d00  0ЍN-M⸓@`pPdh0 104 0 PPUЍ@-P!h  p@P00 0P00 0P0S0S 0T   \0RS00PP RS@-pMP`@000 Q. 0|Q  0P%0S" 0|46 0PpG 0? S *PUPP 0P  ߍ 0q0/`% p@- Q`1T0@L 0@&&&&&&&&&&F ( z `% h@-(0"(Č )d )N  05Ѝ@-h !0! $ d 0 Ѝ@-h("(0  Č! d   #0 Ѝ@-h("(0  Č! d   #0Ѝp@-`P@@ 6Tph@- 0Č ` 0  Ѝh@-!Č 0 ` 0  0ЍF-`pP  P@   y@ pwW0  /`% 4 @-0S$00H`% x %z 0#! Q"Q !R. R+10S/@-@0MP p1h |00Pf0 0@4P0V16&`R PUz/ P1|0S0 S  S @S0000h0pCPdO P <PP P$;    cF]PP &'`  (H Q  0"Q ( 0Q H 0QߍFz dz z z { 9{ s@-P` @P.0 00 !&R   P\dz'0 0<0a0F'P  d|f{ N-M@PPx @ +Pq %Pk 4 040#40   0 0S 00 S  06bP=Mp3`/jP*<ⶠᴰ p  0 S6S a      p6Wߍp@-`P@`P `M@ T8@06P p@p@t% ( ~{ { D-\p\@PX`UV`P~CP4e` P( `% { { { <, <4 /6 R  /@-@Mh0 14  }/  !0P06y h0 104 =Cl h0 14 =7`Ѝp@-(M`@ 0000h0 14 D P z/ !0 PZd= h0 104 = h0 104 =(ЍpN-@P ` pSpT00h3/P LX0000T0Sp00X3/dX`V| P 0l Ӓ0 / ) N-PR(Mp H2`l 6#@PP 0 R @ T Pl㐶&A0R0P  0Pi$`P'<0'8[0 X0'4X 0 %XP0 U$ La0ƚT00X0 _( 0 0 0  0pPS00  3/ P X0ƚ 0@0000S T0X 00 3/ 0 RX0 PPk[T0 p  PqU @P(Ѝ| { q p@-TP2S@Ð` 8,l` L4@2Tp!p| x /| 0@- @0S 4MR%hPQT ] PWp lRT ,00}?0 0K4Ѝ0T USBC| N-D"00M!0R3`@0 h 0倠 0h 0 0僧0 0j}_h0 14   DS !0 PP VW h0 140VMTpWJ X $$ `[ P,0}/0 0  6S  ` i0唶,0U0, U V `F,0PU pW ` ` `06  Br  0ЍT s@-0% @0P$0  `AoP X`FvP `700 0S0SS P10C8#8S |a| F-`M@Ppp* 0Spa 1#40101SPW Y06,03/J P0SSF   R02 00 0\00`0 0[0 0SY06$ 0SP S S  V T d`W Ѝ| | @-h0 14 } 0 ЍN-1 MP@᪑jP` 0h  Ġ`- ``g00T0 S p Ywp  }/ X P 069 W  P2pp}?0 0p' 06  PP d0R\0" 0 BR 0S T QS ЍT USBS| D-aPV@yp'!1Su"1S`q So4 `P`"1 0#1 0S :PS x100t1,00  G/ T100P1LK00S00P 0ĵ 0ĥ00S00 00 %0 Q 7P- `V+ `V( 0S `V" QQ Q  0S % R % h  40$6F``| | #} F-@1$"$PSS "S "S ,0 3/ap?X00 0P 0R0 O $00T0 0pS000 3/1P PU*U_Pb2 RJ Pq0 0 M  AI P VD PQPZP 6P  0: P `((0X0  P%  0T00S000 3/P PUPPP `P10 -=0%=C0Lo QQT| J} { \} D-@, T@p`l 0H`PV P`pl@@`RP "4pb"P 2x lc!#" 5P202QTP U4@42S0 l} | 0 } } p@-P@<` @PTPp~p蠆@-@0P4 @-PB04S u004P,bp0BP! 0PS SS S404j 40 4f$4p0W$4[UIX S0tPM p0wPS;0404 0P= 0 P 4aU0P/ (4S 0|P& @ $40"S (4S  : $ 44P  08#8RD 0 $R@(0LP 4 = > ? < F-@ T P `3P 0TA@@T xP`@0pDAD ZP apDWZapDWWDP 7DP%SPT@TRPF-,AP0P#00(40C4T,T0TTT T$T8T4T4S p` 4*-PP0$R  R0x0 0$l0 $u pGWP( (PCS404u `V*P4  h N-@B P`4Sp] fPP94 $S- 00$$ 4R 44S40SPSP 0SS 0C44S PP R= 4$R: 840S 840c41 B SPu! u4S (PC404jP0,4 (PC404pW*U0 P|0$,4St Z pp  4 g0g44pt,$Z00R0Sw 4 80@-$$(ē $ \$ 44 } } } P@-@ t@40CS0,44/P@ 4 P0/ ,~ @-$TM?Q R1@  @i1S cX1S h[P4 U aP``0 L ,pp R E 0 pW:P0`0UD30<*,<*<* R <*  <* !(!D 1"(#j  p  %     ( *D0G40<*,<*TЍ@~ ~  + S { b@-00@0P 0! R00t 's@- 07@P`&0 PPBU000 (3/`P h  D0 p Ł  p@-@Q0 P S-\ 0L` V"0Sp00@ P/a CRWCA CR7C//PQp@-@p00S0xSXSP` a @00@ SRA0@Sb`P`ppR@-@lM!B ("(!!1 Q I\ PL`|a!1 PK LpP@:TT   d@Td00V 0@ !, R P ! v F0C1! i: l mP`X*lЍp 9 Q i Ȃ \  ݂  '>  + ; U @ p@-P`@  : p RD-@pM&C P3@0S  PHC|P l `0@SPCPHh 0 , P00h0 l   j l |  i j r  i`VP` ` ` p PP0004 $ Q 8 w1:*p゠ P  A  P= P cpW  0  V | & { L`V@ Ax@ 4  `j ;P @  4]  500@#  0S      DPpЍp e ǃ ݃ (  6 L \  b u ʄ _.  . : M '> [ i ~ Ʌ ; U @ 0 1000/p @-@PPP00`A00p T,0@0  \00A@p B( s@-RP70$@@R:@ P` <0T4<0090090 0S0 ) x@ 0Sly0f$0S:<0@4<0090h d|觇 `  F Y @- :/* ,{,w, 40 ,! 4*2%0,.#,* 0p0p18P/3P*.P%0 <)  *< 8 !8 Pp*P 3 ! T  P   H0H 0 Z @ 0 P `` A`00\(T  P/  1(<10S/0@-4MhCS 13 1PP0S SL"P|x2xR d'2. `01`0l01l0`0D1`0Pv1<1 2(20S {Pg}1A d# 0;00;00 ;0 bPNH1!,!|1  $|Y$ %0&'@(@)@@@  4(z P p# 00S .Px@$0?0S UP :Q0( DP!0<*,<*4Ѝ0@p  + A W m ` x h p ݉ ?  _ < @-0S L00L03   l @-@ @n, 0@- ,@ D$@@$ R R \p@-0 0 R , 0P"!C@|`@D `a &`a &`a &`a &TU!p$00S  ,p @-@-   pG-`GQ0PkM[V7p7@Q  `c00 7 P@p @@0ZT U  GP   N-@M`p@@SP`@7pW87p34 W p!V  V0  Z: P p 0. . Z: %P @ gY @Ѝ-  9 #. = N-`Q@P G7 `Vp 0@P 0PUT#2QWV:`Vp0b  Pd@UD-@@M0$00(0040P` <0\pm P 0`pg`pP X0`P`S`V @ 0PeP @Ѝ   # F @-\   @ Č  @T @T\: Sd } N-\ PU d @0p` PUVX V `Q@`V@pbqAPPPaPPP S:P@LS"*`↡ 剡牑q  Z W a ! 0S :@U\01 P3QP5P5 P5@D2@"'A  %*T0Q5 5Ѝ0/0 0 0 X0\0P T0/F-@Pp`0PXP\0`0\U@T:T1 aPy Pl`y ` @ApG000 0Z@:PpU @ A0  b V A0 b !APd  lF9P50@-0 @ PPQ*T*0 S:00N-pP0 00bG p@q0P6`V0:Y ``d Z** `Y `d`d`p  P @D l  P` aV:`d`Z  V R0 pKpG[`Ѝp@-P@`P p袊 0@-P0 @X \@@@DQ@@Q@3T0 S:0  R/0R/\ B/ 0\   R/R@- 0@T R \0  b S @ /0 0c0\  BR0  xs @ pPP  Ap4 jr88 ( Q  R P Pa< `岠Z`,`Ŋ Ǻ`,,`af$ ff(@$D2f 0,<00(@0岠((0D \D` 0P`@ `  V@ PF TX 0`@ T4  P Q PaeAh `lVP` \: `e ` 8`  Z``V:`$Q` q `` `fFa`tQ 4  Pp  @2  a岐DP@   < @`PR Ѝ l P@- 0S @ @4 )@@@ S.@@ @ @(@,@0@8@<@l P L 00S 3/Rp@-@P3 1R<S00-P- 0 0S(0$0  S0$0 0(3/P U0Pe0E2/U0P00ES$0( 3/000$P40p@ppp, , 0%0 8@-@P PU $0S 40S 00S 3/$0(4 3/($0 3/888D-RX@p h%X 0P2U\EPE`VlF`FQ RN0pGP`W`2U\ETPE1-V}GV=0pG00 P `P `P `P `P `P `P `P `P `P `P `P `P `P `P @`TP``,PP,`D W0W 1ERpGPR`PR`P R`P R`P R`P R`P R`PR`PR`PR`PR`PR`PR`PR`PR`P`W  @0 0CP`S(,P,`N-PHM< @T   Y0S00 S8`w R%&b$ PPE>l  00   P4 `Wi  pGePU0S` >L >I 0S&$    D`&dE`D P0`0 0WB  pGePU 0S`0  &4D`E0&8&lF0G`D P0`0 0W!  pGePU 0S  &$ 0  D`&dE`D P0`00+ W pGePU @`R`<` D`&dE`D d` 0S P000 ) @ W010!S Q P  b\ b 00    070@ pc0c@0@0S0@000 +$ W 0 Q0 P @ R7 2@ 5\S:    0 0\pc  0S 0@000 *$ Wz 0 Q0 $P @ (R7 2@ 5\S:    00\pc W 0S$ 00   0WK pGePU1V90P` 0S$ ,  0  4W.  pGePU&,&4,<l04`0P40 00 0S p8`l0L00T0T00/>0l0p P54 0h 0d `00$0uT03L0C (0(00SW* 0pGePPW  pGePU:6cPc0hLPW  pGePU:Q6cPc/  06 &aPE$PW pGePU:6c  a W pGePU:6c  ccP0$ Q4000 h R7hh$Q:0S S>l0L0l 0T0/΄$T0` $0pP|3l0`P00X08X0$0d P<30000S 3/3W[ p 8`6n @-@-X0X@P0U %0c 0 0% *8p &``f` 0P 8@-L0LP@H @D@ @%,0(0@@508$  $ $0000050/  8@-@P~%%d80/ 8@-@8n%@%@`P8@-/P@- P !Ō%Ȍ(0 0@S&!ƌ&X0'ʌ'*A(@T !(!00Sp//,0! `!$ ` R)  `!/0 /0@-01@0S 0T @ @ 00C0'0S @600s0 @& &@ 00C00S `600s<0 `& & 00S Ѝ@Ѝ } 0 @-0`ppT0@P3/P}|0<UATF-@`T pIVVPJ0``@P  Mp x0    00 0@0 000U00  R R  xP  k0 10HP0PPP8^ 6/ ! ( ATF AT ATL /M00000cSЍ/8@-OP8@-O:? ? /@-O0??/@-Xg,c PA CR 00@0S/0/R\R`/ R/00@-@@ @ @T% 0 S0@PP@PU 0@ S@000\ 000Q00000 00 S/D-p@ 000P ZZ0 SS `.00 00 0P SS 0S  S00Dw8@-0< @PR8`\  ͐ 0Q0$00/0S/IFN-R M PɽPUt &Wh1@0`a$0p00C 0PU::U-:?$!000S  㧽PP.  0# 0 000@1/P0 S 0*P0 d ePcX0[! @ T:TPYP P Ѝ F h S 40@-0@$000S@ 巻F 0p@-0M$0P0`0S  o@P X0R  e@P  0(ᒻ叻@ЍpFÑ N-` P pM  0@4 8 < R;0 R7 04 8 ,/ (  P( 04 8 <S:ZSZ Ix 0Dll @0p 000t0x0| PU '> ( 6 < E F-pMP0 /R L"d , 0C0 0Z@Z:< 0 1J uPPll` /7`P dPP((ߍ'> X p@-@TpPPPP P P ڻp@׻: SD-b0P@  Sc0  Sd0  S Sl0  Ss0  S 0 `p㜠f0-0?0p f-0 _00`V  @S0s00  S0s00  T0t0 00 0t N-pM0 /R r`(% Pd JpPؒE@ P ? @ @T:+@ؑD J`P(1S LJ;O/P(2S  `P7&00 y 0P4 8 <V 04 8 , @/D/M 0 $0(0,048<R0`d0h0l V:T 0 S:D $@ZT ` ( (00أC @ % $0ˍ4& 8' <3 s$$L  0$(,# $(3ԓ, #A tJY 3 f<+< ^$ZQZ( dPQ Jq3!1Z cԑI d:Q 4q31J10 1!0 b0 Z$ d 勰 0 0<  P00P00Qv(00#?40 S .4056070 D0#l     0SV(( 8 ۍ'> X Q  $ x 6 00@-SM  R@HP   &0 4S@TЍ05N- M`P. /$iP $  _p常 5Y  P 0PS *U* r $S:U P EUxᓸG S: Q*e Y#  0k r  *Z@ Z !0k r0@ S: 0 d Z#Z   @ 04S   04 8 <S @0<3Q{ 0CQi 0Qqi3Q' 0Qj D0R*  f@@0A B0C0< WZU 04 8 <P1H0 (00R*  ?@ 0! "0#0 0Z.g{P > 04 8 < Q1  R Rt ʷd0Ʒ 04 8 <@@@ P 00U:   0R:Ὸ婷D  Ѝ0 $0(0, 00QJK Pq$0% &0('0 ZdQF Ē   l  7 a '> 8@-P0@P @P@]8( '> N-BM\@sPPpO  %P00EpD`pB  0@4 8 < R0 04 8 <S(:[S[  (0 0 0`0 0 000d0h0l pW [`3( = 0@4 8 < S5 40D46 87 ,5 4046 87 0D?00042 83 ,[0Sh ,0- .0D/08 RSꀓ x $ h 0 5 4046 87 ,PF  054 $6(7,S:90015203 40 60,70<(0015203 40 60,70<0015203 40 60,70<dl  `VLW4pBߍo) '> ( 6 < ݓ % B p@-MP: @d0    SP ` D\ 80S ##  10 $2(3, 54 $6(7, PU4`00 $PⴵU @Ѝp%F ` _ D- M  \pp[q@\ T$ pW`P@ ppfTp@ Tp R`:ۍ0N-`00d0!,;\9i0 `  P@ PV@#` 0!Y @@Rp53@31:@- `Q 0  0 @- P@ `p@p@Ap`` ``Q QA P!@ AR0 !0 b S1# R/@-@   @ p@-0P @`\Vl`@` `@PRp 0RP  /@-p@`P 0PU00p0!R 01 W 0c 0 N-ʾ3@P pPWp 00 0 WBWpGڰ0Wp AoG`FFapGppvp `PV0Fʠ 00:0 0c  R VN-0 M00,0$00 @< 0 @ P5/Z  F- 0@SMf Q б  A0  0V00X0⿮LHV A0ⷮ4E0C,ЍF议 奮 0S 堮 Qꈲ 叮叮冮`P @॔ u멚    b`P0 dXpЍЍFdꯘ q ї  % 0 : A P U q ^ @-@PP00@-0SgP@-0@S#;00CS , 4 < D L L $ \ XTPLHD @< #@.,@꾘 ` d i i o s Ҙ ژ  0 8< 0/PP 0@s//N-!M`P@ 0p4bX1P01L01H0 1D040@080 0,00L0 0(P1*f89 t @x}0@-S@DD ;< 0P, A$00 SA W XG\G$<@-!R 0S1 \Ga q0  ` \RQ 4 SSP000///\Gp@-`P`@0S  P80P000p@ TppXG\G00CS0/ ϪA W @- `1/Ѝ@-\03/@- X1/Ѝ@-T03/@- M( @SR#* `pUTb0K, 00D1/Ѝ@- M( @SR#* `pUTb0K, 00H1/Ѝ@-   `SR*P @PWV:K 0P1/@- d1/Ѝ@-h1/@-0p `@ UT*+ 0 403/P!@PSRK  R0!  R0 L-آ@`pP SR3:+ 0p1/L-آ@`pP SR3:+ 0t1/@-l03/@-x03/@-|03/8@-@P UT*+ 01/88p@- `p@P UT *+ 01/P000pp@-` SR*@T p@PQP:K 0L1/P up000 Jp000N-`@SR0p匐#* U Tb0K4 80@1/P up0 00pgpJp0 00iЍ8@-4 P0R !@PSRK  R0!  R0 00S83/8 D-tp@`PPE0 S 0 00`S` B0@PC0WG 6N-PM4 @RP004 pȕ`jPP   b 00 0Ȑ000 p00 000000000 00005D0H0@S 5H0L0S5L0P0S5P0`0S4`0X0S4X0d0S4d0h0S4h0\0S4\0T0S4T0l0S4l0Wx0S |0S4x04|0p0S4p0t0 Sp4t00Sd400@ST40P4400QP p  0QP*00!0  HQ !0 0L0HHH 0 0 0  0i ث R 0 P 0 00 0Wث[Z: 0+ K 0QP* P  <,P001+ؠ" 0"0 P@Q"@SR*0AP@員!0 R05\!AТ S R:0S   " 20  080<L0#H0~HQ 0;00  0@0DL0$H0cHQ 0D;0ϧ(0(00S + 01/P0000 [Z: 0SP0j0ؠ0+p(`4PWPЍG D  < 0 8 L ` t  ; l } ›   ̛  /N-@P (` pBРppg b  01/ `P@QP* T:N- MP@ `@ + \'0,0$02 72( 7 0Y@ p0 X2 P 0 D01 W*()$&p00h0S  01/ P0SV"R   f403/ P 0S 02S00|0 1 0 P0"1/ P D *Z'"d 0 R0 ,! 01댠눠 Z "Ŧ 0S "ῦ" 0" Т 0[Z:0SX学Y  0 <03/Ѝ c Ŝ  4 P o q N-A(MH@P`Lp  p @PSR*`x@Q0PJD 01/@PE $ 0@e? P@B @ b@@  01/ P b@ P0 N0P@e 0@nW@1$ $@@ 0D 01/@P 0T @20pgp $0@@pc@W@(Ѝ赝 ݝ  + N- M@`Pp@DP SR*t W0\P @ 01/upPG ( 0A B b  01/ P b 0 ܥ0k `p"0c U1@ 01/Pup 0L ᾥ0PeP 0 ` Pcp U ЍD l S@-@P00 b00` PT 000 Ѝps@-@TP0000 ` P T 000Ѝp@Ѝps@-@TP0000 `0P T    Ѝp@Ѝp@-@Pp`H 000 Pu7@-@PP 6P 0P 0 S PP ZWP>@-@@/D-`0@ᲠP pp 00  4  00 0 0p Ѝ@-M 00b00`0@&PPp 0PP0 P:00 0 PPPPЍN-M 00@PpP/ `F P!00 &400`P 0ejZ! 0/P }P P` U: Ѝ0F-P M@`Q/  pQ* '0pp 0mP p F8 00P0  0P4]P`p W: Ѝ'p@- @0 `% VߥPp0S p0080040000 00P @0p /8@-P@㺥P840PP (0""S 0 @0088@߷ 8@-0 Pi0    0 !R 1t* I@0@0480P0082<000H00L0 0408@߷220 /D-PQ@<$ `@!@PpA@@R,Ƞ Ƞ VT< ȌŒ<@ZS@P`PV P<///l0R31L 0 S0@ !,!,!/S0 !+!,!/GP\0 10/Q 1 / 01/ 1@@01/G//p@-@`P @V6S 6S  RP@0`a   0` pGD-xPx`@pP 000嶡 00PU   00蠆GD-pؠP`0A@A(V V Vy@P`sP @@ i@P 00@@pW DT  0@0蠆G@-0@.0i!  001GN-rP0(`!0!0@L0  &P R  H 0 t" #  \"0000 04r 0i! ! s06PPo RD R^ R RRW R] R R RR J RPGh0 300`\0 ! !BP@0 ppU 101 0fS0!W6pv.`fV:)h `  )0 !+ !0P f R` `fV:S BP06VPP 0 0!!- !G N-Tp0   W0``!V@0P  &PR  V"`00`2  2VO 0 0 .01 `03 f00R ! 0  0岱 !'P001 061 0+1p0 5UpPFY 00_ 06\V:p10!p0"$5 UpPI < 0 0 01 0i>00( 00!)P l18 8U8#8lP1f0f S1 0  N l0 `01VH:0!l0$5 UlP06vЍ`G 8@-;p8P@00 0`0S*S 0d00mL0 0 0`0@00 088 G 0u@-4 00`GN-,p0   W0``!V@n0P  &PR i V!`00`1  VM T0 0  00 0 01 0i>0 0( 00 !]P l18 8U8#8lP1f!0f S10   p0 `01VP:0!l0$5 UlPPVv63/VvЍG 80    0`  ` /G@-P@@9`01  pS0  C4 C2 C1  0pp0 BS  0b 0!&!@p q! 0c 0!&!p q!0A@H$HPQG00@-@ A@QG,0A Q/G@-!0` )` h )h  &:C jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z- #+3;CScs@@ !1Aa  0@``Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O A@!  @a`10  @      8 ʌ ތ 8 mnSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec Ĕ ɔ Ҕ l x PF X  @ Ğ ˞ Ҟ @ٞ !B c0@P`p)Jk1s2R"RBrb9{ZӜb$C4 dtDTjK( ōS6r&0vfVF[z8׼HXhx@a(#8َHi +ZJzjqP 3:*˿yX;l|L\",<` A* hI~n^N>2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.>U-Boot 2009.11 (Jun 11 2012 - 10:46:45)i2c_readi2c_writenandnand_select_chipnand_fill_oobnand_transfer_oobnand_get_flash_typenand_scan_tailUVY ZZ YVUe03f] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32UK10_32UND_32UK12_32UK13_32UK14_32SYS_32%pMeth%daddrethactethprime [PRIME] Warning: %s MAC addresses don't match: Address in SROM is %pM Address in environment is %pM ethrotatenounknownnetretryyesoncebad length %d < %d invalid RARP header len bad %d < %d checksum bad ICMP Host Redirect to %pI4 ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again %d.%d.%d.%dnonegatewayipnetmaskserveripnvlan*** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set Using %s device Abort Bytes transferred = %ld (%lx hex) %lXfilesizefileaddr/ Retry count exceeded; starting again T *** ERROR: Cannot mount *** ERROR: Cannot umount done *** ERROR: File lookup fail *** ERROR: Symlink fail /nfsroot/%02lX%02lX%02lX%02lX.img*** Warning: no boot file name; using '%s' File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *autoloadNFSRARP broadcast %d octettimeout%lublksize%c%d%cFile too largeFile has bad magicblksize %lu MB received TFTP error: First block is not block 1 (%ld) Starting again TFTP error: '%s' (%d) tftpblocksizeTFTP from server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx *** WARNING: %s is too long (%d - max: %d) - truncated Host NameRoot PathOpt Boot File*** WARNING: using vendor optional boot file *** Unhandled DHCP Option in OFFER/ACK: %d hostnameDHCP client bound to address %pI4 DHCP: INVALID STATE BOOTP broadcast %d %s(): bogus address length %x %s(): bogus length %x MMC Device %d not found block write failed: %d block read failed: %d Man %06x Snr %08x%c%c%c%c%cCard did not respond to voltage select! %s: %dnand%d%u MiB No NAND device found!!! nand_resume() called for a chip which is not in suspended state BUG: failure at %s:%d/%s()! nand_base.cBUG!nand_write: Attempt to write not page aligned data nand_do_write_ops: Device is write protected Timeout!nand_erase: attempt to erase a bad block at page 0x%08x %s: second ID read did not match %02x,%02x against %02x,%02x No oob scheme defined for oobsize %d No ECC functions supplied, Hardware ECC not possible %d byte HW ECC not possible on %d byte page size, fallback to SW ECC NAND_ECC_NONE selected by board driver. This is not recommended !! Invalid NAND_ECC_MODE %d Invalid ecc parameters create_bbt(): chipnr (%d) > available chips (%d) Bad block table not found for chip %d Bad block table found at page %d, version 0x%02X nand_bbt: Error reading bad block table nand_bbt: ECC error while reading bad block table nand_read_bbt: Reserved block at 0x%012llx nand_read_bbt: Bad block at 0x%012llx No space left to write bad block table nand_bbt: Error reading block for writing the bad block table nand_bbt: ECC error while reading block for writing bad block table Bad block table written to 0x%012llx, version 0x%02X nand_bbt: Error while writing bad block table %d nand_update_bbt: Out of memory nand_scan_bbt: Out of memory nand_bbt: Can't scan flash and build the RAM-based BBT nand_bbt: Out of memory Bad block table at page %d, version 0x%02X NAND 16MiB 1,8V 8-bitNAND 16MiB 3,3V 8-bitNAND 16MiB 1,8V 16-bitNAND 16MiB 3,3V 16-bitNAND 32MiB 1,8V 8-bitNAND 32MiB 3,3V 8-bitNAND 32MiB 1,8V 16-bitNAND 32MiB 3,3V 16-bitNAND 64MiB 1,8V 8-bitNAND 64MiB 3,3V 8-bitNAND 64MiB 1,8V 16-bitNAND 64MiB 3,3V 16-bitNAND 128MiB 1,8V 8-bitNAND 128MiB 3,3V 8-bitNAND 128MiB 1,8V 16-bitNAND 128MiB 3,3V 16-bitNAND 256MiB 3,3V 8-bitNAND 256MiB 1,8V 8-bitNAND 256MiB 1,8V 16-bitNAND 256MiB 3,3V 16-bitNAND 512MiB 1,8V 8-bitNAND 512MiB 3,3V 8-bitNAND 512MiB 1,8V 16-bitNAND 512MiB 3,3V 16-bitNAND 1GiB 1,8V 8-bitNAND 1GiB 3,3V 8-bitNAND 1GiB 1,8V 16-bitNAND 1GiB 3,3V 16-bitNAND 2GiB 1,8V 8-bitNAND 2GiB 3,3V 8-bitNAND 2GiB 1,8V 16-bitNAND 2GiB 3,3V 16-bitToshibaSamsungFujitsuNationalRenesasST MicroHynixMicronAMDUnknown(not set)%-12s= 0x%08lX arch_numberenv_tboot_paramsDRAM bank-> start-> size%-12s= %s ip_addr = %pI4 baudrate = %d bps bdinfoprint Board Info structure## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX gostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsresetPerform RESET of the CPUbootcmd## Transferring control to RTEMS (at address %08lx) ... %lxbootargs## Transferring control to NetBSD stage-2 loader (at address %08lx) ... ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Verifying Checksum ... Bad Data CRC OK Unknown image format! XIP %s ... Loading %s ... Uncompressing %s ... GUNZIP: uncompress, out-of-mem or overwrite error - must RESET board to recover Unimplemented compression type %d verify## Booting kernel from Legacy Image at %08lx ... Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find kernel entry point! Ramdisk image is corrupt or invalid Trying to execute a command out of order cmdline subcommand not supported bdt subcommand not supported prep subcommand not supported WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover autostartERROR: booting os '%s' (%d) is not supported loadoscmdlinebdtprepbootmboot application image from memory[addr [arg ...]] - boot application image stored in memory passing arguments 'arg ...'; when booting a Linux kernel, 'arg' can be the address of an initrd image Sub-commands to do part of the bootm sequence. The sub-commands must be issued in the order below (it's ok to not issue all sub-commands): start [addr [arg ...]] loados - load OS image cmdline - OS specific command line processing/setup bdt - OS specific bd_t processing prep - OS specific prep before relocation or go go - start OSboot default, i.e., run 'bootcmd'bootdiminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)List of available devices: %-8s %08x %c%c%c coninfoprint console devices and informationecho args to console[args..] - echo args to console; \c suppresses newline## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddreth(0,0)%s:%s srv%s:file e=%s h=%s tn=%s ## Not an ELF image, assuming binary ## Using bootline (@ 0x%lx): %s ## Starting vxWorks at 0x%08lx ... ## vxWorks terminated ## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx bootelfBoot from an ELF image in memory [address] - load address of ELF image.bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.exitexit script** No boot file defined ** ** Bad partition %d ** U-BootLoading file "%s" from %s device %d:%d (%.32s) Loading file "%s" from %s device %d ** Bad partition - %s %d:%d ** ** Bad ext2 partition or disk - %s %d:%d ** ** File not found %s %d bytes read %X ** Block device %s %d not supported ** Invalid boot device, use `dev[:part]' ** ** Error ext2fs_ls() ** ext2lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext2loadload binary file from a Ext2 filesystem [addr] [filename] [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystemusage: fatinfo ** Invalid boot device ** ** Unable to use %s %d:%d for fatinfo ** usage: fatls [directory] ** Unable to use %s %d:%d for fatls ** No Fat FS detected usage: fatload [bytes] ** Unable to use %s %d:%d for fatload ** ** Unable to read "%s" from %s %d:%d ** %ld bytes read fatloadload binary file from a dos filesystem [bytes] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystemfatlsfatinfoprint information about filesystem - print information about filesystem from 'dev' on 'interface'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'alias for 'help'%08lx: Error reading the chip, %02lx %04lx %08lx ? Error writing the chip. Error reading the chip. %04x: %02xCRC32 for %08lx ... %08lx ==> Valid chip addresses: %02XCurrent bus speed=%d Setting bus speed to %d Hz Failure changing bus speed (%d) mmmwnmcrprloi2cI2C sub-systemspeed [speed] - show or set I2C bus speed i2c md chip address[.0, .1, .2] [# of objects] - read from I2C device i2c mm chip address[.0, .1, .2] - write to I2C device (auto-incrementing) i2c mw chip address[.0, .1, .2] value [count] - write to I2C device (fill) i2c nm chip address[.0, .1, .2] - write to I2C device (constant address) i2c crc32 chip address[.0, .1, .2] count - compute CRC32 checksum i2c probe - show devices on the I2C bus i2c reset - re-init the I2C Controller i2c loop chip address[.0, .1, .2] [# of objects] - looping read of deviceUnknown operator '%s' Invalid data width specifier -lt<-gt-eq==-ne!=<>-ge>=-le<=itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2noronenandinvalid partition number %d for device %s%d (%s) ### filesystem type is %s JFFS2uImage### %s loading '%s' to 0x%lx ### %s load complete: %d bytes loaded to 0x%lx %x### %s LOAD ERROR<%x> for %s! fsloadload binary file from a filesystem image[ off ] [ filename ] - load binary file from flash bank with offset 'off'[ directory ]fsinfoprint information about filesystems## Total Size = 0x%08x = %d Bytes ## Ready for S-Record upload, press ENTER to proceed ... S0030000FC S3%02X%08lX%s%02X S70500000000FA ## S-Record upload aborted ## S-Record upload complete 0123456789ABCDEF ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'savessave S-Record file over serial line[ off ] [size] - save S-Record file over serial line with offset 'off' and size 'size'loadbload binary file over serial line (kermit mode)[ off ] [ baud ] - load binary file over serial line with offset 'off' and baudrate 'baud'load binary file over serial line (ymodem mode)-vCRC32 for %08lx ... %08lx ==> %08lx CRC32 for %08lx ... %08lx ==> %08lx != %08lx ** ERROR ** Base Address: 0x%08lx Tested %d iteration(s) with %lu errors. Pattern %08lX Writing...%12sReading... Mem error @ 0x%08X: found %08lX, expected %08lX Zero length ??? bytehalfwordword at 0x%08lx (0x%08lx) != word at 0x%08lx (0x%08lx) halfword at 0x%08lx (0x%04x) != halfword at 0x%08lx (0x%04x) byte at 0x%08lx (0x%02x) != byte at 0x%08lx (0x%02x) Total of %ld %s%s were the same %04xmemory display[.b, .w, .l] address [# of objects]memory modify (auto-incrementing address)[.b, .w, .l] addressmemory modify (constant address)memory write (fill)[.b, .w, .l] address value [count]memory copy[.b, .w, .l] source target countcmpmemory compare[.b, .w, .l] addr1 addr2 countcrc32checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr] -v address count crc - verify crc of memory areabaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'loopinfinite loop on address range[.b, .w, .l] address number_of_objectsmtestsimple RAM read/write test[start [end [pattern [iterations]]]]mdcmemory display cyclic[.b, .w, .l] address count delay(ms)mwcmemory write cyclic[.b, .w, .l] address value delay(ms)1000???10010fullhalfIEEE 802.3IEEE 802.9 ISLAN-16T%u. (%04hx) -- %s -- (%04hx:%04hx) %u.%2u,%2u = b%u%u speed selection = %s Mbps%2u = %5u duplex = %s%2u-%2u = %5u selector = %s%2u-%2u = %u selector = %s%2u %2u-%2u = %5u %sFDXHDXPHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x duThe MII dump command only formats the standard MII registers, 0-5. PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities registerloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enable(reserved)100BASE-T4 able100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeremote faultA/N ablelink statusjabber detectextended capabilitiesOUI portionmanufacturer part numbermanufacturer rev. numbernext page ablereservedasymmetric pausepause enable100BASE-TX full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablexxx to doacknowledgeasymmetric pause able100BASE-X full duplex able10BASE-T full duplex able10BASE-T ablemiiMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ !!!)MMCYesNoDevice: %s Manufacturer ID: %x OEM: %x Name: %c%c%c%c%c Tran Speed: %d Rd Block Len: %d %s version %d.%d High Capacity: %s Capacity: %lld Bus Width: %d-bit OKERRORrescanUsage: %s listread MMC read: dev # %d, block # %d, count %d ... %d blocks read: %s write MMC write: dev # %d, block # %d, count %d ... %d blocks written: %s mmcinfommcinfo -- display MMC info mmcMMC sub systemread addr blk# cnt mmc write addr blk# cnt mmc rescan mmc list - lists available devicesmtddevnummtddevname%ug%um%uk%u%s%d,%dcannot add second partition at offset 0 %s%dPartition %s not found on device %s! %s%d: partition (%s) start offsetalignment incorrect %s%d: partition (%s) size alignment incorrect %s%d: partition (%s) start offset alignment incorrect invalid mtd device '%.*s' partition size too small (%lx) no closing ) found in partition name empty partition name no partitions allowed after a fill-up partition unexpected character '%c' at the end of partition out of memory 0x%08lx@0x%08lx%s: offset %08x beyond flash size %08x %s%d: partition (%s) size too big %s: partitioning exceeds flash size no partitions for device %s%d (%s) unexpected character '%c' at the end of device mtdparts=mtdpartsDevice %s not found! incorrect device type in %s incorrect device number in %s no partition number specified unexpected trailing character '%c' no such device %s%d no such partition mtdidsmtdids not defined, no default present mtdids too long (> %d) mtdparts variable not set, see 'help mtdparts' mtdparts too long (> %d) mtdids: incorrect mtdids: no identifier device id %s%d redefined, please correct mtdids variable could not initialise device list mtdparts variable doesn't start with 'mtdparts=' device %s%d redefined, please correct mtdparts variable mtdparts_init: no valid partitions defaultdelall device %s%d <%s>, # parts = %d #: name size offset mask_flags %2d: %-20s0x%08x 0x%08x %d no partitions defined active partition: %s%d,%d - (%s) 0x%08x @ 0x%08x could not get current partition info defaults: mtdids : %s mtdparts: %s addno such device %s defined in mtdids variable too long partition description %s:%s(%s)%sgenerated mtdparts too long, reseting to null delcurrent partition deleted, resetting current to 0 partition %s not found no partition id specified partition changed to %s%d,%d chpartchange active partitionpart-id - change active partition (e.g. part-id = nand0,1)define flash/nand partitions - list partition table mtdparts delall - delete all partitions mtdparts del part-id - delete partition (e.g. part-id = nand0,1) mtdparts add [@] [] [ro] - add partition mtdparts default - reset partition table to defaults ----- this command uses three environment variables: 'partition' - keeps current partition identifier partition := := ,part_num 'mtdids' - linux kernel mtd device id <-> u-boot device id mapping mtdids=[,,...] := = := 'nand'|'nor'|'onenand' := mtd device number, 0... := unique device tag used by linux kernel to find mtd device (mtd->name) 'mtdparts' - partition list mtdparts=mtdparts=[;...] := :[,...] := unique device tag used by linux kernel to find mtd device (mtd->name) := [@][][] := standard linux memsize OR '-' to denote all remaining space := partition start offset within the device := '(' NAME ')' := when set to 'ro' makes partition read-only (not used, passed to kernel)%dx %s, sector size %u KiB not a NAND device '%s' is not a number device %d whole chip offset 0x%lx, size 0x%zx .jffs2.e.iUnknown nand load suffix '%s' Loading from %s, offset 0x%lx ** Read error ** Unknown image type Automatic boot of image at addr 0x%08lx ... Not a NAND device bootdevice ** No boot device ** ** Device %d not available No memory for page buffer Error (%d) reading page %08lx Page %08lx dump: %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x %02x OOB: %02x %02x %02x %02x %02x %02x %02x %02x scruberasewrittenquietNo such device Device %d: %s... is now current device dumpmarkbadbiterrunlock no devices available Device %d bad blocks: %08lx clean NAND %s: Warning: scrub option will erase all factory set bad blocks! There is no reliable way to recover them. Use this command only for testing purposes if you are sure of what you are doing! Really scrub this NAND flash? scrub aborted .oobUnknown nand command suffix '%s'. %zu bytes %s: %s block 0x%08lx NOT marked as bad! ERROR %d block 0x%08lx successfully marked as bad NAND sub-systeminfo - show available NAND devices nand device [dev] - show or set current device nand read - addr off|partition size nand write - addr off|partition size read/write 'size' bytes starting at offset 'off' to/from memory address 'addr', skipping bad blocks. nand erase [clean] [off size] - erase 'size' bytes from offset 'off' (entire device if not specified) nand bad - show bad blocks nand dump[.oob] off - dump page nand scrub - really clean NAND erasing bad blocks (UNSAFE) nand markbad off [...] - mark bad block(s) at offset (UNSAFE) nand biterr off - make a bit error at offset (UNSAFE)nbootboot from NAND device[partition] | [[[loadAddr] dev] offset]ping failed; host %s is not alive host %s is alive rootpathdnsipdnsip2domainAutomatic boot of image at addr 0x%08lX ... bootpboot image via network using BOOTP/TFTP protocol[loadAddress] [[hostIPaddr:]bootfilename]tftpbootboot image via network using TFTP protocolrarpbootboot image via network using RARP/TFTP protocoldhcpboot image via network using DHCP/TFTP protocolnfsboot image via network using NFS protocolpingsend ICMP ECHO_REQUEST to network hostpingAddressSaving Environment to %s... ## Error: illegal character '=' in variable name "%s" stdoutstderrCan't delete "%s" ## Baudrate %d bps not supported ## Error: environment overflow, "%s" deleted Please enter '%s':setenvedit: Environment size: %d/%ld bytes ## Error: "%s" not defined saveenvsave environment variables to persistent storageeditenvedit environment variablename - edit environment variable 'name'printenvprint environment variables - print values of all environment variables printenv name ... - print value of environment variable 'name'set environment variablesname value ... - set environment variable 'name' to 'value ...' setenv name - delete environment variable 'name'askenvget environment variables from stdinname [message] [size] - get environment variable 'name' from stdin (max 'size' chars) askenv name - get environment variable 'name' from stdin askenv name size - get environment variable 'name' from stdin (max 'size' chars) askenv name [message] size - display 'message' string and get environment variable 'name'from stdin (max 'size' chars)runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'probeFailed to initialize SPI flash at %u:%u %u KiB %s at %u:%u is now current device Usage: sf probe [bus:]cs [hz] [mode] No SPI flash selected. Please run `sf probe' Failed to map physical memory SPI flash %s failed Usage: sf %s addr offset len Usage: sf erase offset len sfSPI flash sub-systemprobe [bus:]cs [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset len - read `len' bytes starting at `offset' to memory at `addr' sf write addr offset len - write `len' bytes from memory at `addr' to flash at `offset' sf erase offset len - erase `len' bytes from `offset'Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command ## Executing script at %08lx sourcerun script from memory[addr] - run script starting at addr - A valid image header must be presentHex conversion error on %c, giving up. Invalid bitlen %d, giving up. Invalid device %d, giving up. Error with the SPI transaction. sspiSPI utility commands - Send bits from out the SPI - Identifies the chip select of the device - Number of bits to send (base 10) - Hexadecimal string that gets sent-o-a-z-nminimal test like /bin/sh[args..]falsedo nothing, unsuccessfullytruedo nothing, successfullystorage device not initialized. Use usb scan Rawerror reading partinfo...try to boot raw PPCBoot ** Invalid partition type "%.32s" (expect "U-Boot") Loading from USB device %d, partition %d: Name: %.32s Type: %.32s ** Bad Header Checksum ** ** Read error on %d:%d See InterfaceAudioCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificHuman Interface, Subclass: NoneBoot KeyboardMouseMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk onlyString: "%s"%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d Self Powered Bus Powered Remote Wakeup Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - InOut - Endpoint %d %s ControlIsochronousInterrupt MaxPacket %d Interval %dms480 Mb/s1.5 Mb/s12 Mb/s+- %s (%s, %dmA) %s %s %s %s (Re)start USB... stopstopping USB.. USB is stopped. Please issue 'usb start' first. tree Device Tree: infconfig for device %d *** NO Device avaiable *** storprint_part of %x no USB devices available no current device selected USB read: device %d block # %ld, count %ld ... %ld blocks read: %s dev USB device %d: unknown device Device %d: usbUSB sub-systemreset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr'usbbootboot from USB deviceloadAddr dev:partprint monitor version## Copying part %d from legacy image at %08lx ... Wrong Compression Type for %s command Bad Image Part Invalid image type for imxtract %8lximxtractextract a part of a multi-imageaddr part [dest] - extract from legacy image at and copy to %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands U-Boot > In: No input devices available! Out: No output devices available! Err: No error devices available! *** Warning - bad CRC, using default environment Environment SPI flash not initialized Erasing SPI flash...Writing to SPI flash...SPI Flashsyntax error %s=%s ** Abort ERROR : memory not allocated *?[\ERROR: There is a global environment variable with the same name. %s: readonly variableIFS \$'";&|#Unknown command '%s' - try 'help' or use 'run' command Unknown command '%s' - try 'help' 'bootd' recursion detected ;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelsefiforwhileuntildonebootm_lowbootm_size%d Bytes = Unknown OSUnknown ArchitectureUnknown ImageUnknown Compression%sImage Name: %.*s %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image Wrong Ramdisk Image Format ## Loading init Ramdisk from multi component Legacy Image at %08lx ... uncompressedbzip2bzip2 compressedgzipgzip compressedlzmalzma compressedlzolzo compressedInvalid ImageFilesystem ImagefirmwareFirmwarekernelKernel ImagemultiMulti-File ImageramdiskRAMDisk ImageScriptstandaloneStandalone Programflat_dtFlat Device TreekwbimageKirkwood Boot ImageInvalid ARCHalphaAlphaarmARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsmips64MIPS 64 BitniosNIOSnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32Invalid OSlinuxLinuxnetbsdNetBSDrtemsRTEMSu-bootqnxQNXvxworksVxWorks%.*sverbootdelayHit any key to stop autoboot: %2d %2d ** Too many args (max. %d) ** ## Command too long! miiphy_register: non unique device name '%s' miiphy_register: cannot allocate memory for '%s' No such device: %s NULL device name! MII devices: '%s' Current device: '%s' PHY reset timed out PHY speedPHY AN speed read failed, assuming 10BASE-T PHY duplexPHY AN duplex read failed, assuming half duplex serial ERROR: NOT USB_CONFIG_DESC %x unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dERROR, too many USB Devices, max=%d ERROR: USB_MAX_HUB (%d) reached Couldn't reset port %i USB device not accepting new address (error=%lX) unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) failed to set default configuration len %d, status %lX usb_new_device:cannot locate device's port. cannot reset port %i!? No USB Device found %d USB Device(s) found USB: scanning bus for devices... Error, couldn't init Lowlevel part Device NOT ready Request Sense returned %02X %02X %02X No storage devices, perhaps not 'usb start'ed..? Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. error in inquiry READ_CAP ERROR scanning bus for storage devices... max USB Storage Device reached: %d stopping %d Storage Device(s) found CRCCksumxyzModem - %s mode, %d(SOH)/%d(STX)/%d(CAN) packets, %d retries Unknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access fileNo DSP on this chip Loading coff data from address 0x%08x ## Not a DSP COFF image at address 0x%08x No Optional Header / Entry Point found ... loading %d bytes to address 0x%08x Starting DSP at address 0x%08x bootdspBoot DSP from an a.out COFF image in memory [address] - load address of DSP image. Error - unable to probe SPI flash. Error - unable to erase SPI FLASH sector : %d Error - unable to write config block from SPI flash. Error - unable to read config block CRC from SPI flash. Error Writing I2C Configuration Block I2C Factory Configuration Block Saved error reading I2C Configuration Block Error - Factory Configuration Invalid You must set the factory configuration to make permanent Error - unable to read config block from SPI flash. Error - Checksum on MityDSP-L138 Config Block Checksum Invalid You must set the config to FLASH to make permanent Factory Configuration: Config Version : %d.%d MAC Address : %02X:%02X:%02X:%02X:%02X:%02X Serial Number : %d FPGA Type : %d [%s] Part Number : %s %02X:%02X:%02X:%02X:%02X:%02XMAC Address : Serial Number :Part Number :FPGA Type :saveConfiguration Saved Unknown Option MityDSP-L138 Configuration: Config Version : %d.%d Config Size : %d Manufacturer : %s Ethernet Config : %d Ethernet Name : %s Ethernet PHYMask: %x LCD Config : %d LCD Panel : %s MMC0 Config : %d MMC1 Config : %d Ethernet Config : UART - %d Configuration --- Enable UART : Baud : HW Flow Control : Is Console : SPI - %d Configuration --- Enable SPI : CLK is Output : Chip Select [%d] Enable : ENA ENable : CLK Rate : LCD Configuration LCD Enable : Panel Name : MMC 0 Configuration MMC 0 Enable : Write Protect Pin bank : Write Protect Pin bank offset : Card Detect Pin bank : Card Detect Pin bank offset : XC6SLX9XC6SLX16XC6SLX25XC6SLX45mitydsp-l138 config block operations - print current configuration config set - set new configuration config save - write new configuration to SPI FLASH factoryconfigmitydsp-l138 factory config block operations - print current configuration factoryconfig set - set new configuration factoryconfig save - write new configuration to I2C FLASH Disabling PROGRAM PIN Loading FPGA from 0x%08X with 0x%X bytes WARNING: INIT Pin Did Not go low after 1 ms WARNING: INIT Pin is Low at start of data cycle Loading FPGA done Invalid Address loadfpgaloadfpga addr [length] [np] - load fpga with data at addr (hex) of length (hex) bytes - if np is set, the PROGRAM_PIN will not be pulled (for debugging) ARM Clock : %d Hz DDR Clock : %d Hz EMIFA CLock : %d Hz DSP Clock : %d Hz ASYNC3 Clock : %d Hz Enet config : %d MMC 0 Enable : %d Resetting ethernet phy Resetting MII ethernet phy %02x:%02x:%02x:%02x:%02x:%02xbootfpgadspwake%2ld.%ld %cB%s1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d Error: Bad gzipped data Error: gunzip out of data in header ERROR: Failed to allocate 0x%lx bytes below 0x%lx. (null)invalid distance too far backinvalid distance codeinvalid literal/length codeincorrect header checkunknown compression methodinvalid window sizeunknown header flags setheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkneed dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionRead from EEPROM @ 0x%02x failed Warning: MAC addresses don't match: EEPROM MAC address: %pM "ethaddr" value: %pM + emac_ch_teardown - emac_ch_teardown WARN: emac_send_packet: No link + emac_close - emac_close + emac_open - emac_open WARN: emac_rcv_pkt: Error in packet INFO:emac_rcv_packet: RX Queue not active INFO: emac_rcv_pkt: active queue head = 0 INFO: emac_rcv_pkt: active queue head = 0, HDP fired phyaddrdavinci_eth_phy_detect(), ALIVE = 0x%08x GENERIC @ 0x%02xEthernet PHY: %s [0x%X] No ETH PHY detected!!! machidUsing machid 0x%x from environment Starting kernel ... resetting ... FAT32 FAT12 FAT16 Invalid FAT entry ** Can't read from device %d ** FAT** Partition %d not valid on device %d ** %s%c %8ld %s%c %d file(s), %d dir(s) Error reading cluster No current device Interface: IDESATAATAPIUSBDOC Device %d: No valid FAT fs found Partition %d: Filesystem: %s "%s" reading %s add_node: malloc failed add_node failed! get_fl_mem_nand: can't alloc %d bytes read_nand_cached: can't alloc cache size %d bytes read_nand_cached: error reading nand off %#x size %d bytes get_fl_mem: unknown device type, using raw offset! off = %#x magic %#x type %#x node.totlen = %d get_node_mem: unknown device type, using raw offset! ** ERROR ** %*.*s%s %08x has dup version =find_inode failed for name=xwr%.3s %.3s %.2d %.2d:%.2d:%.2d %d %s %8ld %s %s -> Scanning JFFS2 FS: offset %08x already seen, skip . OOPS Cleanmarker has bad size %d != %zu OOPS Padding has bad size %d < %zu Unknown node type: %x len %d offset 0x%x  done. %s: Failed to scan JFFSv2 file structure ls: Failed to scan jffs2 file structure load: Failed to find inode has dup version (resolve) = load: Failed to resolve inode structure UNKOWN COMPRESSION METHOD = load: Failed to read inode Compression: %s frag count: %d compressed sum: %d uncompressed sum: %d NONEZERORTIMERUBINMIPSCOPYDYNRUBINZLIB** ext2fs read block (indir 1) malloc failed. ** ** ext2fs read block (indir 1) failed. ** ** ext2fs read block (indir 2 1) malloc failed. ** ** ext2fs read block (indir 2 1) failed. ** ** ext2fs read block (indir 2 2) malloc failed. ** ** ext2fs read block (indir 2 2) failed. ** ** ext2fs doesn't support tripple indirect blocks. ** < ? > %10d %s ** Can not find directory. ** Failed to mount ext2 filesystem... ** ext2fs_devread() read outside partition sector %d ** Invalid Block Device Descriptor (NULL) ** ext2fs_devread() read error ** ** ext2fs_devread() read error - block ** ext2fs_devread() read error - last part (%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s device type DOC device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Capacity: %ld.%ld MB = %ld.%ld GB (%ld x %ld) Capacity: not available Partition Map for UNKNOWN device %d -- Partition Type: %s DOS## Unknown partition table ** Can't read partition table on %d:%d ** bad MBR sector signature 0x%02x%02x hd%c%dsd%c%dusbd%c%ddocd%c%dxx%c%d Extd 1 0 %10ld %2x %5d %10d %10d %2x%s Partition Start Sector Num Sectors Type [ ST0 ERROR %x] Status %x Timeout ST0:%x ST1:%x davinciU-Boot BUG at %s:%d! mtdcore.cRemoving MTD device #%d (%s) with use count %d Creating %d MTD partitions on "%s": memory allocation error while creating partitions for "%s" Moving partition %d: 0x%012llx -> 0x%012llx 0x%012llx-0x%012llx : "%s" mtd: partition "%s" is out of reach -- disabled mtd: partition "%s" extends beyond the end of device "%s" -- size truncated to %#llx mtdpart.cmtd: partition "%s" doesn't start on an erase block boundary -- force read-only mtd: partition "%s" doesn't end on an erase block -- force read-only Warning: Erase size 0x%08lx smaller than one erase block 0x%08x Erasing 0x%08x instead Skipping bad block at 0x%08llx %s: MTD get bad block failed: %d %s: MTD Erase failure: %d %s: MTD writeoob failure: %d Erasing at 0x%llx -- %3d%% complete. Cleanmarker written at 0x%llx.Attempt to write non page aligned data Attempt to write outside the flash area NAND write to offset %llx failed %d Skip bad block 0x%08llx Attempt to read outside the flash area NAND read from offset %llx failed %d Skipping bad block 0x%08llx M25P16M25P20M25P32M25P40M25P64M25P80M25P128raise: Signal # %d caught h ,W ̃ hn p?&0PQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~N@ҩ @ҩ ҩ @ҩ  ĩ  ȩ ̩ Bbt01tbBqq 3@ s@ C@ S@ 5 @ u @4 E @K U @b 6@@x v@@ F@@ V@@ x@ 9@ y@ r@ I@ t@ Y@ q@b @x @ @ @    1  H ` x        , A V l  @       ,   ( !"#$%&'()*+,-./0123456789:;<=>?p 8 8 8 8 8 8  8 8 @8 8  8 8 :1 >1 @1 S1 D1 H1 K1 O1 R1 U1 Y1 \1 `1 @;? P? d? v? ? ? < t   4 G ? ? ? ?  @ @ 7y @ ?3@ >@ N@ j@ @ @ @ @ @ 3@ A A +A 8A AA MA [A qA  ?qA ?}A A A A +A A A A >@ A B B -B =B A GB +A 3@ SB ^B >@ iB B B B =B ̴ ̴ Դ Դ ܴ ܴ       $ $ , , 4 4 < < D D L L T T \ \ d d l l t t | | ĵ ĵ ̵ ̵ Ե Ե ܵ ܵ       $ $ , , 4 4 < < D D L L T T \ \ d d l l t t | | Ķ Ķ ̶ ̶ Զ Զ ܶ ܶ       $ $ , , 4 4 < < D D L L T T \ \ d d l l t t | | ķ ķ ̷ ̷ Է Է ܷ ܷ       $ $ , , 4 4 < < D D L L T T \ \ d d l l t t | | ĸ ĸ bootargs=mem=96M console=ttyS1,115200n8 root=/dev/mtdblock0 rw rootwaitbootcmd=sf probe 0;sf read 0xc0700000 0x100000 0x280000;bootm 0xc0700000bootdelay=3baudrate=115200bootfile="uImage"flashuboot=tftp 0xc0700000 mityomap/u-boot-ubl.bin; sf probe 0; sf erase 0x10000 0x80000; sf write 0xc0700000 0x10000 ${filesize}flashkernel=tftp 0xc0700000 mityomap/uImage; sf probe 0; sf erase 0x100000 0x280000; sf write 0xc0700000 0x100000 ${filesize}flashubl=tftp 0xc0700000 mityomap/UBL_SPI_MEM.ais; sf probe 0; sf erase 0 0x10000; sf write 0xc0700000 0 0x10000flashrootfs=tftp 0xc2000000 mityomap/mityomap-base-mityomapl138.jffs2; nand erase 0 0x08000000; nand write.jffs2 0xc2000000 0 ${filesize}serverip=10.0.0.23autoload=nomtdids=nand0=nandmtdparts=mtdparts=nand:128M(rootfs),-(userfs)bootargsbase=mem=96M console=ttyS1,115200n8flashargs=setenv bootargs ${bootargsbase} ${mtdparts} root=/dev/mtdblock0 rw,noatime rootfstype=jffs2Lq gs `s 8es js  os rs vs  |s  8[ DB s dw ow uw {w w w w w ' w w w w 8 8 wv v v v v v v v v v v v v v v v v v v v v w  w w w w f w %w +w 1w 9w Fw Ow Xw ^w 8 8 u ) u u u u u u u v v d' v #v .v Av Iv Zv cv 8 8 B Iu Vu \u mu ru u u u u 8 8   _ %] ,] ( w B     'b 8,P¿80-000258RC-1 Rev B8Critical LinkPISharp_LQ035Q7DH060(((((AAAAAABBBBBB `dhlptHY PY XY Y @U \ 8    G lh M 8  ! w  # 8 .#  # 8 4# ;# j# m$ u$ 8 4 L$ $ & & & '  ' *' Z' L_' 8 ( ( ) k) |t) ) + + + , ( ) , , , - - >- = - 8 . . . c1 i1 1 2 2 2 ( ( 3 3 '3 8 6 (6 +6 o6 u6 6 6 6 *7 (5 7 *7 k p9 9 . L9 : . (%: : . F: Z: 8\ 8}: : : : : : ,: : m; `r; ; ; @< !< H< N< i< < D< < < \< < B B B \D p bD D "F  *F 8 PF 8 TF cF dN  % kN N I   N N 1 . 9X IX Z `* Z Z h[ : n[ [ [ : [ [ [ : \ [ 6\ 9 ;\ [ k\ 9 o\ [ \ H6 \ \ ] (: ] 8 -^ B 5^ O^ {^ pC ^ ^ ] A _ ._ _ @@ _ _ :a  >a fa b D b b d (I d d e pI e e d< ,K f f f K f f $K f l |[ l l cn O kn n ` n 8 8o <` Ao ao r P r r     چ  # H ӆ   j  s